Menu

Adropin (34-76) (Human, Rat, Mouse) - Biotin Labeled

Quantity:

Catalog #
Size
Price
B-032-35 20 µg $369

Sequence:  ()
CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Disulfide bridge(s): Cys34-Cys56
  • Validation:
  • Exhibits correct molecular weight
  • Contents:
  • Each vial contains 20 µg of NET labeled peptide.

No References

Related Products

Catalog# Product Size Price Buy Now