Nesfatin-1 (1-82) (Rat)
- Product Category: Peptides
Catalog #: 003-22A
Size: 20 µg
Price: $213
Ala
A
Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Val-Glu-Pro-Val-Glu-Ser-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-Arg-Ser-Gly-Arg-Leu-Ser-Gln-Glu-Leu-Asp-Leu-Val-Ser-His-Lys-Val-Arg-Thr-Arg-Leu-Asp-Glu-Leu
VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Structure:
No results found.
Peripheral effects of nesfatin-1 on glucose homeostasis.
Li Z, Gao L, Tang H, et al. PLoS ONE. 2013;8(8):e71513.
Nesfatin-1 induces Fos expression and elicits dipsogenic responses in subfornical organ.
Moreau JM, Ciriello J. Behav Brain Res. 2013;250:343-50.
Nesfatin-1 influences the excitability of glucosensing neurons in the hypothalamic nuclei and inhibits the food intake.
Chen X, Dong J, Jiang ZY. Regul Pept. 2012;177(1-3):21-6.
Nucleobindin-2/nesfatin in the endocrine pancreas: distribution and relationship to glycaemic state.
Foo KS, Brauner H, Ostenson CG, Broberger C. J Endocrinol. 2010;204(3):255-63.
Central nesfatin-1 reduces dark-phase food intake and gastric emptying in rats: differential role of corticotropin-releasing factor2 receptor.
Stengel A, Goebel M, Wang L, et al. Endocrinology. 2009;150(11):4911-9.
Nesfatin-1 crosses the blood-brain barrier without saturation.
Pan W, Hsuchou H, Kastin AJ. Peptides. 2007;28(11):2223-8.