Neurosecretory Protein GM (NPGM) /FAM273B(45-112)-amide (Rat)
- Product Category: Peptides
Catalog #: 049-85
Size: 100μg
Price: $484
Ala
A
DLQCWNTCSLTLIDLKEIKIEHNVDAFWNFMLFLQKSQRPGHYSVFLNIAQDFWDMYIDCLLSRSHGM-NH2
Disulfide Bridge(s): Disulfide Bridge: Cys1-Cys2
Molecular Weight: 8137.47
Purity: ≥ 94%
Validation: Exhibits correct molecular weight
Solubility: Dissolve peptide with small amount of 50% Acetonitrile
Storage: Up to 6 months in lyophilized form at 0-5ºC.
For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Contents: Each vial contains 100 μg of NET peptide.
No results found.