PACAP 38 (Human, Rat, Ovine)
- Product Category: Peptides
Catalog #: 052-05
Size: 200 µg
Price: $113
Sequence: Ala
A
His-Ser-Asp-Gly-IlePhe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
HSDGXTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKX
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Structure:
No results found.
GalR3 activation promotes adult neural stem cell survival in response to a diabetic milieu.
Mansouri S, Barde S, Ortsäter H, et al. J Neurochem. 2013;127(2):209-20.
Western Blot Semi-Quantitative Analysis of Non-Canonical cAMP-Dependent Protein Expression Induced by PACAP.
Jones E, Holighaus Y, Eiden L. CiteSeerx10M. 2013.
Rapgef2 connects GPCR-mediated cAMP signals to ERK activation in neuronal and endocrine cells.
Emery AC, Eiden MV, Mustafa T, Eiden LE. Sci Signal. 2013;6(281):ra51.
Discrete signal transduction pathway utilization by a neuropeptide (PACAP) and a cytokine (TNF-alpha) first messenger in chromaffin cells, inferred from coupled transcriptome-promoter analysis of regulated gene cohorts.
Samal B, Ait-ali D, Bunn S, Mustafa T, Eiden LE. Peptides. 2013;45:48-60.
The hop cassette of the PAC1 receptor confers coupling to Ca2+ elevation required for pituitary adenylate cyclase-activating polypeptide-evoked neurosecretion.
Mustafa T, Grimaldi M, Eiden LE. J Biol Chem. 2007;282(11):8079-91.
Signaling mechanisms for alpha2-adrenergic inhibition of PACAP-induced growth hormone secretion and gene expression grass carp pituitary cells.
Wang X, Chu MM, Wong AO. Am J Physiol Endocrinol Metab. 2007;292(6):E1750-62.
Neuroprotection by endogenous and exogenous PACAP following stroke.
Chen Y, Samal B, Hamelink CR, et al. Regul Pept. 2006;137(1-2):4-19.
Vasoactive intestinal peptide and PACAP38 control N-methyl-D-aspartic acid-induced dendrite motility by modifying the activities of Rho GTPases and phosphatidylinositol 3-kinases.
Henle F, Fischer C, Meyer DK, Leemhuis J. J Biol Chem. 2006;281(34):24955-69.
Pituitary adenylate cyclase-activating polypeptide 27 is a functional ligand for formyl peptide receptor-like 1.
Kim Y, Lee BD, Kim O, et al. J Immunol. 2006;176(5):2969-75.
Secretin: hypothalamic distribution and hypothesized neuroregulatory role in autism.
Welch MG, Keune JD, Welch-horan TB, et al. Cell Mol Neurobiol. 2004;24(2):219-41.
Analysis of the PC12 cell transcriptome after differentiation with pituitary adenylate cyclase-activating polypeptide (PACAP).
Vaudry D, Chen Y, Ravni A, Hamelink C, Elkahloun AG, Eiden LE. J Neurochem. 2002;83(6):1272-84.