Adropin (34-76) (Human, Rat, Mouse)
- Product Category: Peptides
Catalog #: 032-35
Size: 100 µg
Price: $334
Sequence: Ala
A
Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro
CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Structure:
No results found.
Circulating adropin concentrations in pediatric obstructive sleep apnea: potential relevance to endothelial function.
Gozal D, Kheirandish-gozal L, Bhattacharjee R, Molero-ramirez H, Tan HL, Bandla HP. J Pediatr. 2013;163(4):1122-6.
Low circulating adropin concentrations with obesity and aging correlate with risk factors for metabolic disease and increase after gastric bypass surgery in humans.
Butler AA, Tam CS, Stanhope KL, et al. J Clin Endocrinol Metab. 2012;97(10):3783-91.
Adropin is a novel regulator of endothelial function. Circulation.
Lovren F, Pan Y, Quan A, et al. 2010;122(11 Suppl):S185-92.