Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Peptides
BNP-32 (Human)
Catalog No. 011-03
Catalog #: 011-03
Size: 200 µg
Price: $156
Show 1-letter code
Sequence:
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Molecular Weight: 3464.7 Purity: ≥ 95% Validation: Exhibits correct molecular weight Solubility: Soluble in water Storage: Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles. Appearance: White powder Contents: Each vial contains 200 µg of NET peptide. Disulfide Bridge: Disulfide bridge(s): Cys10-Cys26 Intra-Assay CV: <10% Inter-Assay CV: <15% Sample Extraction: Standard Curve:
Immunoreactivity and guanosine 3',5'-cyclic monophosphate activating actions of various molecular forms of human B-type natriuretic peptide. Heublein DM, Huntley BK, Boerrigter G, et al. Hypertension. 2007;49(5):1114-9.
Des-serine-proline brain natriuretic peptide 3-32 in cardiorenal regulation. Boerrigter G, Costello-boerrigter LC, Harty GJ, Lapp H, Burnett JC. Am J Physiol Regul Integr Comp Physiol. 2007;292(2):R897-901.
Surface electrochemical enzyme immunoassay for the highly sensitive measurement of B-type natriuretic peptide. Matsuura H, Sato Y, Niwa O, Mizutani F. Proceedings of the Tenth International Meeting on Chemical Sensors. 2004;108(1-2):603-7.
trans fatty acids and systemic inflammation in heart failure. Mozaffarian D, Rimm EB, King IB, Lawler RL, Mcdonald GB, Levy WC. Am J Clin Nutr. 2004;80(6):1521-5.
Dendroaspis natriuretic peptide relaxes isolated human arteries and veins. Best PJ, Burnett JC, Wilson SH, Holmes DR, Lerman A. Cardiovasc Res. 2002;55(2):375-84.
Institutional Access
Available only to verified institutional research accounts for in vitro laboratory research and preclinical studies.
Account Eligibility