Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Add to Cart
First-time checkout is released after institutional account review.
| Sequence: | H(Aib)EGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPS(Pen)NH2 |
| Molecular Weight: | 4192.63 |
| Purity: | ≥ 95% |
| Validation: | Exhibits correct molecular weight |
| Storage: | Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles. |
| Appearance: | White powder |
| Contents: | Each VIAL contains 100 µg NET peptide |