KiSS-1 (68-121) amide / Kisspeptin-54 / Metastin (1-54) amide (Human)
- Product Category: Peptides
Catalog #: 048-59
Size: 100 µg
Price: $314
Ala
A
Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF=-Amide
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Structure:
No results found.
Immunohistochemical evidence for the presence of various kisspeptin isoforms in the mammalian brain.
Franceschini I, Yeo SH, Beltramo M, et al. J Neuroendocrinol. 2013;25(9):839-51.
Presence of kisspeptin-like immunoreactivity in human adrenal glands and adrenal tumors.
Takahashi K, Shoji I, Shibasaki A, et al. J Mol Neurosci. 2010;41(1):138-44.
Studies of the localisation of kisspeptin within the pituitary of the rhesus monkey (Macaca mulatta) and the effect of kisspeptin on the release of non-gonadotropic pituitary hormones.
Ramaswamy S, Gibbs RB, Plant TM. J Neuroendocrinol. 2009;21(10):795-804.
An increase in kisspeptin-54 release occurs with the pubertal increase in luteinizing hormone-releasing hormone-1 release in the stalk-median eminence of female rhesus monkeys in vivo.
Keen KL, Wegner FH, Bloom SR, Ghatei MA, Terasawa E. Endocrinology. 2008;149(8):4151-7.
Sex steroids and leptin regulate the “first Kiss” (KiSS 1/G-protein-coupled receptor 54 system) in human gonadotropin-releasing-hormone-secreting neuroblasts.
Morelli A, Marini M, Mancina R, et al. J Sex Med. 2008;5(5):1097-113.
Expression of a functional g protein-coupled receptor 54-kisspeptin autoregulatory system in hypothalamic gonadotropin-releasing hormone neurons.
Quaynor S, Hu L, Leung PK, et al. Mol Endocrinol. 2007;21(12):3062-70.
The role of kisspeptin-GPR54 signaling in the tonic regulation and surge release of gonadotropin-releasing hormone/luteinizing hormone.
Dungan HM, Gottsch ML, Zeng H, et al. J Neurosci. 2007;27(44):12088-95.
The kisspeptin receptor GPR54 is required for sexual differentiation of the brain and behavior.
Kauffman AS, Park JH, Mcphie-lalmansingh AA, et al. J Neurosci. 2007;27(33):8826-35.
A role for kisspeptins in the regulation of gonadotropin secretion in the mouse.
Gottsch ML, Cunningham MJ, Smith JT, et al. Endocrinology. 2004;145(9):4073-7.