Parathyroid Hormone (PTH) (1-34) (Human)
- Product Category: Peptides
Catalog #: 055-08
Size: 500 µg
Price: $188
Ala
A
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Molecular Weight: 4117.77
Purity: ≥ 97%
Validation: Exhibits correct molecular weight
Solubility: Soluble in water
Storage: Up to 6 months in lyophilized form at 0-5°C.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Contents: Each vial contains 500 µg of NET peptide.
MSDS: View/Download (PDF)
Structure:
No results found.
The proteasome inhibitor bortezomib affects osteoblast differentiation in vitro and in vivo in multiple myeloma patients.
Giuliani N, Morandi F, Tagliaferri S, et al. Blood. 2007;110(1):334-8.
Isogenic human cell lines for drug discovery: regulation of target gene expression by engineered zinc-finger protein transcription factors.
Liu PQ, Tan S, Mendel MC, et al. J Biomol Screen. 2005;10(4):304-13.