Prolactin-Releasing Peptide-31 (PrRP-31) (Human)
- Product Category: Peptides
Catalog #: 008-50
Size: 200 µg
Price: $198
Ala
A
Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF=-Amide
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Structure:
No results found.
Prolactin (PRL)-releasing peptide stimulates PRL secretion from human fetal pituitary cultures and growth hormone release from cultured pituitary adenomas.
Rubinek T, Hadani M, Barkai G, Melmed S, Shimon I. J Clin Endocrinol Metab. 2001;86(6):2826-30.
Identification of receptors for neuromedin U and its role in feeding.
Howard AD, Wang R, Pong SS, et al. Nature. 2000;406(6791):70-4.
Prolactin-releasing peptide-immunoreactivity in A1 and A2 noradrenergic neurons of the rat medulla.
Chen C, Dun SL, Dun NJ, Chang JK. Brain Res. 1999;822(1-2):276-9.