RAR-Related Orphan Receptor A isoform D (426-468) (Human)
- Product Category: Peptides
Catalog #: 002-73
Size: 100 µg
Price: $374
Ala
A
Cys-Gly-Arg-His-Thr-Glu-Lys-Leu-Met-Ala-Phe-Lys-Ala-Ile-Tyr-Pro-Asp-Ile-Val-Arg-Leu-His-Phe-Pro-Pro-Leu-Tyr-Lys-Glu-Leu-Phe-Thr-Ser-Glu-Phe-Glu-Pro-Ala-Met-Gln-Ile-Asp-Gly
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Molecular Weight: 5040.91
Validation: Exhibits correct molecular weight
Solubility: Soluble in water
Storage: Up to 6 months in lyophilized form at 0-5°C.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Contents: Each vial contains 100 µg of NET peptide.
Structure:
No results found.