Relaxin 2 C-peptide (56-127) (Human)
- Product Category: Peptides
Catalog #: 036-80
Size: 100 µg
Price: $428
Ala
A
Ser-Leu-Ser-Gln-Glu-Asp-Ala-Pro-Gln-Thr-Pro-Arg-Pro-Val-Ala-Glu-Ile-Val-Pro-Ser-Phe-Ile-Asn-Lys-Asp-Thr-Glu-Thr-Ile-Asn-Met-Met-Ser-Glu-Phe-Val-Ala-Asn-Leu-Pro-Gln-Glu-Leu-Lys-Leu-Thr-Leu-Ser-Glu-Met-Gln-Pro-Ala-Leu-Pro-Gln-Leu-Gln-Gln-His-Val-Pro-Val-Leu-Lys-Asp-Ser-Ser-Leu-Leu-Phe-Glu-Glu-Phe-Lys-Lys-Leu-Ile-Arg-Asn-Arg-Gln-Ser-Glu-Ala-Ala-Asp-Ser-Ser-Pro-Ser-Glu-Leu-Lys-Tyr-Leu-Gly-Leu-Asp-Thr-His-Ser
SLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHS
Molecular Weight: 11464.02
Purity: ≥ 95%
Validation: Exhibits correct molecular weight
Solubility: Soluble in water
Storage: Up to 6 months in lyophilized form at 0-5ºC.
For best results, rehydrate just before use.
After rehydration, keep solution at +4ºC for up to 5 days or freeze at -20ºC for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
For best results, rehydrate just before use.
After rehydration, keep solution at +4ºC for up to 5 days or freeze at -20ºC for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Contents: Each vial contains 100 μg of NET peptide.
Structure:
No results found.