Stresscopin (SCP) (Human)
- Product Category: Peptides
Catalog #: 019-26
Size: 100 µg
Price: $198
Ala
A
Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2
TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI=-Amide
Molecular Weight: 4367.2
Purity: ≥ 95%
Validation: Exhibits correct molecular weight
Solubility: Soluble in water
Storage: Up to 6 months in lyophilized form at 0-5°C.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Contents: Each vial contains 100 µg of NET peptide.
Structure:
No results found.
Klampfl SM, Brunton PJ, Bayerl DS, Bosch OJ. Hypoactivation of CRF receptors, predominantly type 2, in the medial-posterior BNST is vital for adequate maternal behavior in lactating rats.
Bisschops et al. CRF-induced calcium signaling in guinea pig small intestine myenteric neurons involves CRF-1 receptors and activation of voltage-sensitive calcium channels.