Exendin-4 (Heloderma suspectum)
- Product Category: Peptides
Catalog #: 070-94
Size: 100 µg
Price: $192
Sequence: Ala
A
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
For best results, rehydrate just before use.
After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles.
Appearance: White powder
Structure:
No results found.
Obestatin promotes survival of pancreatic beta-cells and human islets and induces expression of genes involved in the regulation of beta-cell mass and function.
Granata R, Settanni F, Gallo D, et al. Diabetes. 2008;57(4):967-79.
Urocortin 3 regulates glucose-stimulated insulin secretion and energy homeostasis.
Li C, Chen P, Vaughan J, Lee KF, Vale W. Proc Natl Acad Sci USA. 2007;104(10):4206-11.
Entry of exendin-4 into brain is rapid but may be limited at high doses.
Kastin AJ, Akerstrom V. Int J Obes Relat Metab Disord. 2003;27(3):313-8.