Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
[pGlu0]-GLP-1 (7-36) amide (Human, Rat, Mouse, Porcine, Bovine, Canine, Ovine) – Biotin Labeled
Catalog No. B-028-23
Add to Cart
First-time checkout is released after institutional account review.
| Sequence: | Biotinyl-pGlu-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (Biotinyl)(pGlu)HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR(NH2) |
| Molecular Weight: | 3632.96 |
| Purity: | ≥ 90% |
| Validation: | Exhibits correct molecular weight |
| Solubility: | Insoluble in water. Dissolve in 10-20 µl of 60% acetonitrile in water or DMSO then dilute with water or any desired buffer. |
| Storage: | Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. After rehydration, keep solution at +4°C for up to 5 days or freeze at -20¬∞C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles. |
| Appearance: | White powder |
| Contents: | Each vial contains 10 µg of NET labeled peptide. |
| Intra-Assay CV: | <10% |
| Inter-Assay CV: | <15% |