Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Peptides
Neuropeptide Y (NPY) (Human, Rat, Mouse)
Catalog No. 049-03
Catalog #: 049-03
Size: 200 µg
Price: $143
Show 1-letter code
Sequence:
Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY(NH2) Molecular Weight: 4271.73 Purity: ≥ 96% Validation: Exhibits correct molecular weight Solubility: Soluble in water Storage: Up to 6 months in lyophilized form at 0-5°C. Appearance: White powder Contents: Each vial contains 200 µg of NET peptide. Intra-Assay CV: <10% Inter-Assay CV: <15% Sample Extraction: Standard Curve:
Limited effects of beta-endorphin compared to loperamide or fentanyl in a neuroendocrine biomarker assay in non-human primates. Butelman ER, Reed B, Chait BT, Mandau M, Yuferov V, Kreek MJ. Psychoneuroendocrinology. 2008;33(3):292-304.
Brain-derived neurotrophic factor in the ventromedial nucleus of the hypothalamus reduces energy intake. Wang C, Bomberg E, Levine A, Billington C, Kotz CM. Am J Physiol Regul Integr Comp Physiol. 2007;293(3):R1037-45.
GABA excitation in mouse hilar neuropeptide Y neurons. Fu LY, Van den pol AN. J Physiol (Lond). 2007;579(Pt 2):445-64.
Melanocortins and agouti-related protein modulate the excitability of two arcuate nucleus neuron populations by alteration of resting potassium conductances. Smith MA, Hisadome K, Al-qassab H, Heffron H, Withers DJ, Ashford ML. J Physiol (Lond). 2007;578(Pt 2):425-38.
Food intake in rhesus monkeys following central administration of orexins. Ramsey JJ, Kemnitz JW, Newton W, Hagopian K, Patterson TA, Swick AG. Regul Pept. 2005;124(1-3):209-14.
Short-term exposure to constant light promotes strong circadian phase-resetting responses to nonphotic stimuli in Syrian hamsters. Knoch ME, Gobes SM, Pavlovska I, Su C, Mistlberger RE, Glass JD. Eur J Neurosci. 2004;19(10):2779-90.
Identification of receptors for neuromedin U and its role in feeding. Howard AD, Wang R, Pong SS, et al. Nature. 2000;406(6791):70-4.
Institutional Access
Available only to verified institutional research accounts for in vitro laboratory research and preclinical studies.
Account Eligibility
