Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Add to Cart
First-time checkout is released after institutional account review.
| Sequence: | Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
| Molecular Weight: | 3938.4 |
| Purity: | ≥ 95% |
| Validation: | Exhibits correct molecular weight |
| Solubility: | Soluble in water |
| Storage: | Up to 6 months in lyophilized form at 0-5°C. For best results, rehydrate just before use. After rehydration, keep solution at +4°C for up to 5 days or freeze at -20°C for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles. |
| Appearance: | White powder |
| Contents: | Each vial contains 200 µg of NET peptide. |
| Intra-Assay CV: | <10% |
| Inter-Assay CV: | <15% |
| Sample Extraction: | |
| Standard Curve: |