Home
/
Peptides
/
Peptide YY (PYY) (3-36) (Rat, Mouse, Porcine, Canine)
Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Peptides
Peptide YY (PYY) (3-36) (Rat, Mouse, Porcine, Canine)
Catalog No. 059-04
Catalog #: 059-04
Size: 200 µg
Price: $104
Show 1-letter code
Sequence:
Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY(NH2) Molecular Weight: 3980.44 Purity: ≥ 95% Validation: Exhibits correct molecular weight Solubility: Soluble in water Storage: Up to 6 months in lyophilized form at 0-5°C. Appearance: White powder Contents: Each vial contains 200 µg of NET peptide. Intra-Assay CV: <10% Inter-Assay CV: <15% Sample Extraction: Standard Curve:
Leptin extends the anorectic effects of chronic PYY(3-36) administration in ad libitum-fed rats. Unniappan S, Kieffer TJ. Am J Physiol Regul Integr Comp Physiol. 2008;295(1):R51-8.
Chronic PYY3-36 treatment promotes fat oxidation and ameliorates insulin resistance in C57BL6 mice. Van den hoek AM, Heijboer AC, Voshol PJ, et al. Am J Physiol Endocrinol Metab. 2007;292(1):E238-45.
PYY(3-36) reduces food intake and body weight and improves insulin sensitivity in rodent models of diet-induced obesity. Vrang N, Madsen AN, Tang-christensen M, Hansen G, Larsen PJ. Am J Physiol Regul Integr Comp Physiol. 2006;291(2):R367-75.
Effects of dipeptidyl peptidase IV on the satiety actions of peptide YY. Unniappan S, Mcintosh CH, Demuth HU, Heiser U, Wolf R, Kieffer TJ. Diabetologia. 2006;49(8):1915-23.
Effect of total colectomy and PYY infusion on food intake and body weight in rats. Babu M, Purhonen AK, Bansiewicz T, et al. Regul Pept. 2005;131(1-3):29-33.
Institutional Access
Available only to verified institutional research accounts for in vitro laboratory research and preclinical studies.
Account Eligibility
