Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Add to Cart
First-time checkout is released after institutional account review.
| Sequence: | FAM-Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 (FAM)SRTHRHSMEIRTPDINPAWYASRGIRPVGRF(NH2) |
| Molecular Weight: | 3992.18 |
| Validation: | Exhibits correct molecular weight |
| Solubility: | Soluble in 50mM sodium phosphate buffer (pH 8.5) or 10% DMSO in PBS buffer (pH 7.5). |
| Storage: | Store at -20°C with desiccant.For best results and reproducibility, rehydrate peptide just before use. Do not refreeze any portions. Protect the fluorescent peptide from light, especially in solution. |
| Contents: | Each vial contains 1 nmol of NET labeled peptide. |
| Intra-Assay CV: | <10% |
| Inter-Assay CV: | <15% |
| Sample Extraction: | |
| Absorption: | 495 nm Extinction Coefficient: 77400 M-1 cm-1 |
| Fluorescent Dye: | mono-5(6)-Carboxyfluorescein (FAM) |
| Max Emission: | 519 nm |
| Standard Curve: |