Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Add to Cart
First-time checkout is released after institutional account review.
| Sequence: | pGlu-Arg-Ser-Ser-Arg-Thr-Phe-Leu-Ser-Glu-Ile-Arg-Trp-Gly-Lys-Lys-Leu-Gly-Glu-Pro-Pro-Gly-Phe-Leu-His-Ser-Trp-Cys-Cys-Val-Phe-Trp-Asp-Leu-Tyr-Leu-Ala-Ala-Pro (pGlu)RSSRTFLSEIRWGKKLGEPPGFLHSWCCVFWDLYLAAP |
| Molecular Weight: | 4566.31 |
| Purity: | ≥95% purity |
| Validation: | Exhibits correct molecular weight |
| Storage: | Store in dry form at 0-5°C. |
| Appearance: | White powder |
| Contents: | Peptide contains two free cysteine. Each vial contains 100 µg of NET peptide. |