Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
Add to Cart
First-time checkout is released after institutional account review.
| Sequence: | Met-His-Met-Glu-Lys-Leu-Ser-Gly-Arg-Ala-His-Thr-Ser-Phe-Tyr-Met-Ser-Lys-Ser-Thr-Leu-Glu-Arg-Ser-Pro-Gly-Asp-Val-Lys-Arg-Asp-Ala-Thr-Leu-Phe-Ile-Tyr-Ala-His-Ser-Cys-Gly-Thr-Ser-Lys-Lys-His-Asn MHMEKLSGRAHTSFYMSKSTLERSPGDVKRDATLFIYAHSCGTSKKHN |
| Molecular Weight: | 5443.19 |
| Purity: | ≥95% purity |
| Validation: | Exhibits correct molecular weight |
| Storage: | Store peptide in DRY form at 0-5°C. |
| Appearance: | White powder |
| Contents: | Peptide contain free Cys and tends to dimerize after long-term storage. Each vial contains 100 µg of NET peptide. |