Verified institutional research accounts only. Supplied for in vitro laboratory research and preclinical studies.
[Biotinyl-Gln1]-TCAP-1 / Teneurin C-terminal Associated Peptide-1 (Human)
Catalog No. B-020-16
Add to Cart
First-time checkout is released after institutional account review.
| Sequence: | Biotin-Gln-Gln-Leu-Leu-Ser-Thr-Gly-Arg-Val-Gln-Gly-Tyr-Asp-Gly-Tyr-Phe-Val-Leu-Ser-Val-Glu-Gln-Tyr-Leu-Glu-Leu-Ser-Asp-Ser-Ala-Asn-Asn-Ile-His-Phe-Met-Arg-Gln-Ser-Glu-Ile-NH2 (Biotin)QQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEI(NH2) |
| Molecular Weight: | 4962.5 |
| Purity: | ≥ 95% |
| Validation: | Exhibits correct molecular weight |
| Storage: | Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. After rehydration, keep solution at +4ºC for up to 5 days or freeze at -20ºC for up to 3 months. Aliquot before freezing to avoid repeated freeze-thaw cycles. |
| Appearance: | White powder |
| Contents: | Each vial contains 20 μg of NET biotin peptide. |
| Intra-Assay CV: | <10% |
| Inter-Assay CV: | <15% |
| Sample Extraction: | |
| Standard Curve: |